PELI1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2101651
Artikelname: PELI1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2101651
Hersteller Artikelnummer: orb2101651
Alternativnummer: BYT-ORB2101651-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PELI1
Konjugation: Biotin
Alternative Synonym: DKFZp686C18116, MGC50990
PELI1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 065702
UniProt: Q8C669
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA