PPP4R3B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2101658
Artikelname: PPP4R3B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2101658
Hersteller Artikelnummer: orb2101658
Alternativnummer: BYT-ORB2101658-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human P4R3B
Konjugation: HRP
Alternative Synonym: PSY2, smk1, FLFL2, SMEK2, PP4R3B
PPP4R3B Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 30kDa
UniProt: Q5MIZ7
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: EYVQTFKGLKTKYEQEKDRQNQKLNSNRFRRDAKALEEDEEMWFNEDEEE