PNMA8A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2102120
Artikelname: PNMA8A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2102120
Hersteller Artikelnummer: orb2102120
Alternativnummer: BYT-ORB2102120-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNMAL1
Konjugation: HRP
Alternative Synonym: PNMAL1
PNMA8A Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 060685
UniProt: Q86V59
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ