Enah Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2102123
Artikelname: Enah Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2102123
Hersteller Artikelnummer: orb2102123
Alternativnummer: BYT-ORB2102123-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Enah
Konjugation: HRP
Alternative Synonym: Me, Nd, Mena, WBP8, Ndpp1, NDPP-1
Enah Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 84kDa
NCBI: 001076589
UniProt: E9QKR1
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: RRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNG