Tmlhe Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2102136
Artikelname: Tmlhe Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2102136
Hersteller Artikelnummer: orb2102136
Alternativnummer: BYT-ORB2102136-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tmlhe
Konjugation: FITC
Alternative Synonym: Tmlh
Tmlhe Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 596878
UniProt: Q91ZW6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG