NKAPD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2102146
Artikelname: NKAPD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2102146
Hersteller Artikelnummer: orb2102146
Alternativnummer: BYT-ORB2102146-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf57
Konjugation: Biotin
Alternative Synonym: C11orf57
NKAPD1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 060665
UniProt: Q6ZUT1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RWGHSGYKELYPEEFETDSSDQQDITNGKKTSPQVKSSTHESRKHKKSKK