RIC8B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2102163
Artikelname: RIC8B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2102163
Hersteller Artikelnummer: orb2102163
Alternativnummer: BYT-ORB2102163-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIC8B
Konjugation: FITC
Alternative Synonym: RIC8, hSyn
RIC8B Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 060627
UniProt: A2RTZ0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL