FAM135B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2102757
Artikelname: FAM135B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2102757
Hersteller Artikelnummer: orb2102757
Alternativnummer: BYT-ORB2102757-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM135B
Konjugation: FITC
Alternative Synonym: C8ORFK32
FAM135B Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 156kDa
NCBI: 056996
UniProt: Q49AJ0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV