PLEKHA9 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2102769
Artikelname: PLEKHA9 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2102769
Hersteller Artikelnummer: orb2102769
Alternativnummer: BYT-ORB2102769-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLEKHA9
Konjugation: FITC
Alternative Synonym: FAPP2, FAPP-2, hFAPP2, PLEKHA8, PLEKHA9
PLEKHA9 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 056983
UniProt: O95397
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VGTLLKSTCNTFLKTLEECMQIANAAFTSELLYHTPPGSPQLAMLKSSKM