ACHE Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2102778
Artikelname: ACHE Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2102778
Hersteller Artikelnummer: orb2102778
Alternativnummer: BYT-ORB2102778-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACHE
Konjugation: FITC
Alternative Synonym: YT, ACEE, ARACHE, N-ACHE
ACHE Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 056646
UniProt: P22303
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV