Sema3f Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2103145
Artikelname: Sema3f Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2103145
Hersteller Artikelnummer: orb2103145
Alternativnummer: BYT-ORB2103145-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: Biotin
Alternative Synonym: Sem, Sema4, Semak
Sema3f Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 035479
UniProt: O88632
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH