RAP1GAP Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2103255
Artikelname: RAP1GAP Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2103255
Hersteller Artikelnummer: orb2103255
Alternativnummer: BYT-ORB2103255-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAP1GAP
Konjugation: FITC
Alternative Synonym: RAPGAP, RAP1GA1, RAP1GAP1, RAP1GAPII
RAP1GAP Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 002876
UniProt: P47736
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQ