RALB Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2103267
Artikelname: RALB Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2103267
Hersteller Artikelnummer: orb2103267
Alternativnummer: BYT-ORB2103267-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RALB
Konjugation: FITC
RALB Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 002872
UniProt: P36860
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE