RAD23B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2103275
Artikelname: RAD23B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2103275
Hersteller Artikelnummer: orb2103275
Alternativnummer: BYT-ORB2103275-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD23B
Konjugation: HRP
Alternative Synonym: P58, HR23B, HHR23B
RAD23B Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 002865
UniProt: P54727
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP