MVK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104012
Artikelname: MVK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104012
Hersteller Artikelnummer: orb2104012
Alternativnummer: BYT-ORB2104012-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MVK
Konjugation: Biotin
Alternative Synonym: MK, LRBP, MVLK, POROK3
MVK Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 000422
UniProt: Q03426
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KEDLELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSP