NPHP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104060
Artikelname: NPHP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104060
Hersteller Artikelnummer: orb2104060
Alternativnummer: BYT-ORB2104060-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NPHP1
Konjugation: Biotin
Alternative Synonym: NPH1, JBTS4, SLSN1
NPHP1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 000263
UniProt: O15259
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG