LRRC37A3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104087
Artikelname: LRRC37A3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104087
Hersteller Artikelnummer: orb2104087
Alternativnummer: BYT-ORB2104087-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRC37A3
Konjugation: Biotin
Alternative Synonym: LRRC37, LRRC37A
LRRC37A3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 180kDa
NCBI: 955372
UniProt: O60309
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS