GADL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104162
Artikelname: GADL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104162
Hersteller Artikelnummer: orb2104162
Alternativnummer: BYT-ORB2104162-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GADL1
Konjugation: Biotin
Alternative Synonym: ADC, CSADC, HuADC, HuCSADC
GADL1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 997242
UniProt: Q6ZQY3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGA