PRAME Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104192
Artikelname: PRAME Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104192
Hersteller Artikelnummer: orb2104192
Alternativnummer: BYT-ORB2104192-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRAME
Konjugation: Biotin
Alternative Synonym: MAPE, OIP4, CT130, OIP-4
PRAME Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 006106
UniProt: P78395
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPR