ANKRD47 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104372
Artikelname: ANKRD47 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104372
Hersteller Artikelnummer: orb2104372
Alternativnummer: BYT-ORB2104372-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD47
Konjugation: Biotin
Alternative Synonym: ANKRD47
ANKRD47 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 86kDa
NCBI: 940873
UniProt: Q6NY19
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR