GANAB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104378
Artikelname: GANAB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104378
Hersteller Artikelnummer: orb2104378
Alternativnummer: BYT-ORB2104378-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GANAB
Konjugation: Biotin
Alternative Synonym: G2AN, GIIA, PKD3, GLUII
GANAB Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 107kDa
NCBI: 938148
UniProt: Q14697
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHL