Usp12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104459
Artikelname: Usp12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104459
Hersteller Artikelnummer: orb2104459
Alternativnummer: BYT-ORB2104459-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Usp12
Konjugation: Biotin
Alternative Synonym: Ubh1
Usp12 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 035799
UniProt: Q9D9M2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIAD