LEMD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104495
Artikelname: LEMD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104495
Hersteller Artikelnummer: orb2104495
Alternativnummer: BYT-ORB2104495-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LEMD2
Konjugation: Biotin
Alternative Synonym: LEM2, NET25, CTRCT42, dJ482C21.1
LEMD2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 851853
UniProt: Q8NC56
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH