PRR30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104525
Artikelname: PRR30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104525
Hersteller Artikelnummer: orb2104525
Alternativnummer: BYT-ORB2104525-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf53
Konjugation: Biotin
Alternative Synonym: C2orf53
PRR30 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 848648
UniProt: Q53SZ7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PQGKATQACGHQLPASQPPAAQARADPVPGTPSQTRSFRSAGLQSPNSPR