Tmem102 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104537
Artikelname: Tmem102 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104537
Hersteller Artikelnummer: orb2104537
Alternativnummer: BYT-ORB2104537-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: Biotin
Alternative Synonym: Cb, Cbap, Tmem102-, Tmem102-ps, 4632403M07Rik
Tmem102 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 001028605
UniProt: Q3UPR7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KDFVFALLGLVHRQDPRFPPQAELLLLRGGIREGSLDLGHAPLGPYSRGP