RASGEF1C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104591
Artikelname: RASGEF1C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104591
Hersteller Artikelnummer: orb2104591
Alternativnummer: BYT-ORB2104591-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASGEF1C
Konjugation: Biotin
Alternative Synonym: FLJ35841
RASGEF1C Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 778232
UniProt: Q8N431
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE