DNAH6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104675
Artikelname: DNAH6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104675
Hersteller Artikelnummer: orb2104675
Alternativnummer: BYT-ORB2104675-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human DYH6
Konjugation: Biotin
Alternative Synonym: HL2, HL-2, DNHL1, Dnahc6
DNAH6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
UniProt: Q9C0G6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGL