CABCOCO1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104726
Artikelname: CABCOCO1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104726
Hersteller Artikelnummer: orb2104726
Alternativnummer: BYT-ORB2104726-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat RGD1306739
Konjugation: Biotin
Alternative Synonym: RGD1306739
CABCOCO1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 001128048
UniProt: D3ZD36
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PLGGFTIDDVKLALARVTDEVLISIQNEINEKLQVQEESFNARIEKLKKA