MED19 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104786
Artikelname: MED19 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104786
Hersteller Artikelnummer: orb2104786
Alternativnummer: BYT-ORB2104786-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MED19
Konjugation: Biotin
Alternative Synonym: LCMR1, DT2P1G7, MED19AS
MED19 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 703151
UniProt: A0JLT2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH