LRWD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104843
Artikelname: LRWD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104843
Hersteller Artikelnummer: orb2104843
Alternativnummer: BYT-ORB2104843-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of RAT LOC304396
Konjugation: Biotin
Alternative Synonym: LOC304396
LRWD1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 001014003
UniProt: Q66HB0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EPLHFLQCHSRNNSPKDLETQLWACAFEPAREEGHSGATSQTVATCGGEA