C9orf43 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104846
Artikelname: C9orf43 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104846
Hersteller Artikelnummer: orb2104846
Alternativnummer: BYT-ORB2104846-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf43
Konjugation: Biotin
Alternative Synonym: MGC17358
C9orf43 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 689999
UniProt: Q8TAL5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE