TRIB2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2105137
Artikelname: TRIB2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2105137
Hersteller Artikelnummer: orb2105137
Alternativnummer: BYT-ORB2105137-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIB2
Konjugation: Biotin
Alternative Synonym: C5FW, TRB2, GS3955
TRIB2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 067675
UniProt: Q92519
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE