LDLRAP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2105254
Artikelname: LDLRAP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2105254
Hersteller Artikelnummer: orb2105254
Alternativnummer: BYT-ORB2105254-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LDLRAP1
Konjugation: Biotin
Alternative Synonym: ARH, ARH1, ARH2, FHCB1, FHCB2, FHCL4
LDLRAP1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 056442
UniProt: Q5SW96
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: WTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKK