ACOT11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2105302
Artikelname: ACOT11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2105302
Hersteller Artikelnummer: orb2105302
Alternativnummer: BYT-ORB2105302-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACOT11
Konjugation: Biotin
Alternative Synonym: BFIT, THEA, THEM1, STARD14
ACOT11 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 65
NCBI: 671517
UniProt: D3DQ50
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL