SAMHD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2105335
Artikelname: SAMHD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2105335
Hersteller Artikelnummer: orb2105335
Alternativnummer: BYT-ORB2105335-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SAMHD1
Konjugation: Biotin
Alternative Synonym: DCIP, CHBL2, HDDC1, MOP-5, SBBI88, hSAMHD1
SAMHD1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 72kDa
NCBI: 056289
UniProt: Q9Y3Z3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF