FBXO28 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2105419
Artikelname: FBXO28 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2105419
Hersteller Artikelnummer: orb2105419
Alternativnummer: BYT-ORB2105419-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXO28
Konjugation: Biotin
Alternative Synonym: Fbx28, CENP-30
FBXO28 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 055991
UniProt: Q9NVF7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK