KHDC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2105503
Artikelname: KHDC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2105503
Hersteller Artikelnummer: orb2105503
Alternativnummer: BYT-ORB2105503-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0907
Konjugation: Biotin
Alternative Synonym: BLOM7, KIAA0907, SNORA80EHG
KHDC4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 055764
UniProt: Q7Z7F0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ELPDERESGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERER