Cpne7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2105620
Artikelname: Cpne7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2105620
Hersteller Artikelnummer: orb2105620
Alternativnummer: BYT-ORB2105620-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Konjugation: Biotin
Alternative Synonym: Cpne7
Cpne7 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 001101924
UniProt: D3ZWR4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GDDGILRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEY