DDAH1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2105971
Artikelname: DDAH1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2105971
Hersteller Artikelnummer: orb2105971
Alternativnummer: BYT-ORB2105971-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDAH1
Konjugation: Biotin
Alternative Synonym: DDAH, DDAHI, DDAH-1, HEL-S-16
DDAH1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 036269
UniProt: O94760
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT