PRDX5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2106019
| Artikelname: |
PRDX5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2106019 |
| Hersteller Artikelnummer: |
orb2106019 |
| Alternativnummer: |
BYT-ORB2106019-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human PRDX5 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
PLP, ACR1, B166, PRXV, PMP20, PRDX6, prx-V, SBBI10, AOEB166, HEL-S-55 |
| PRDX5 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
17 kDa |
| UniProt: |
P30044 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: VACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSI |
