CCT5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2106034
Artikelname: CCT5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2106034
Hersteller Artikelnummer: orb2106034
Alternativnummer: BYT-ORB2106034-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCT5
Konjugation: Biotin
Alternative Synonym: CCTE, HEL-S-69, PNAS-102, CCT-epsilon, TCP-1-epsilon
CCT5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 036205
UniProt: P48643
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE