CENPI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2106067
Artikelname: CENPI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2106067
Hersteller Artikelnummer: orb2106067
Alternativnummer: BYT-ORB2106067-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CENPI
Konjugation: Biotin
Alternative Synonym: LRPR1, CENP-I, FSHPRH1
CENPI Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 57kDa
UniProt: Q92674
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTL