CENPI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2106070
Artikelname: CENPI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2106070
Hersteller Artikelnummer: orb2106070
Alternativnummer: BYT-ORB2106070-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENPI
Konjugation: Biotin
Alternative Synonym: LRPR1, CENP-I, FSHPRH1
CENPI Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 87kDa
NCBI: 006724
UniProt: Q92674
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV