HADH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2106148
Artikelname: HADH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2106148
Hersteller Artikelnummer: orb2106148
Alternativnummer: BYT-ORB2106148-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HADH
Konjugation: Biotin
Alternative Synonym: HAD, HCDH, HHF4, HADH1, SCHAD, HADHSC, MSCHAD
HADH Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 005318
UniProt: Q16836
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLV