FKBP5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2106235
| Artikelname: |
FKBP5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2106235 |
| Hersteller Artikelnummer: |
orb2106235 |
| Alternativnummer: |
BYT-ORB2106235-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human FKBP5 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
P54, AIG6, FKBP51, FKBP54, PPIase, Ptg-10 |
| FKBP5 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
51kDa |
| NCBI: |
004108 |
| UniProt: |
Q13451 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: KMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESW |
