FDXR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2106247
Artikelname: FDXR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2106247
Hersteller Artikelnummer: orb2106247
Alternativnummer: BYT-ORB2106247-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FDXR
Konjugation: Biotin
Alternative Synonym: ADR, ADXR, ANOA
FDXR Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 077728
UniProt: P22570
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW