LUM Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2106263
Artikelname: LUM Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2106263
Hersteller Artikelnummer: orb2106263
Alternativnummer: BYT-ORB2106263-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LUM
Konjugation: HRP
Alternative Synonym: LDC, SLRR2D
LUM Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 002336
UniProt: P51884
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: AFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRF