LUM Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2106264
Artikelname: LUM Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2106264
Hersteller Artikelnummer: orb2106264
Alternativnummer: BYT-ORB2106264-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LUM
Konjugation: FITC
Alternative Synonym: LDC, SLRR2D
LUM Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 002336
UniProt: P51884
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRF