GNB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2106346
Artikelname: GNB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2106346
Hersteller Artikelnummer: orb2106346
Alternativnummer: BYT-ORB2106346-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNB1
Konjugation: Biotin
Alternative Synonym: MDS, MRD42
GNB1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 002065
UniProt: P62873
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT