FRK Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2106387
Artikelname: FRK Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2106387
Hersteller Artikelnummer: orb2106387
Alternativnummer: BYT-ORB2106387-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FRK
Konjugation: FITC
Alternative Synonym: GTK, RAK, PTK5
FRK Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 002022
UniProt: P42685
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH